PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004514527.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 200aa    MW: 22800.6 Da    PI: 9.3096
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004514527.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF81.84.3e-26958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    krien   rqvtf+kRr+g+lKKA+ELSvLCdae+ ++ifs +gklye +
  XP_004514527.1  9 KRIENPVHRQVTFCKRRAGLLKKAKELSVLCDAEIGLVIFSAHGKLYELA 58
                    79*********************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.137161IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-35160IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.62E-28175IPR002100Transcription factor, MADS-box
CDDcd002653.72E-40279No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-28323IPR002100Transcription factor, MADS-box
PfamPF003191.5E-231056IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-283859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.48787177IPR002487Transcription factor, K-box
PfamPF014861.6E-2190169IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MARGKVQLKR IENPVHRQVT FCKRRAGLLK KAKELSVLCD AEIGLVIFSA HGKLYELATK  60
GTMQGLIEKY LKFTRGTQSE AITEPRPLDA KEETDVLKQE IETLQKGIRY LFGGGLGTLK  120
MDELQVLEKN LENWMYHVRT MKMNIMLQEI QALRDKEGTL KAANKYLHDL VLENTSVTNF  180
VPFATDTSYP LIIQDGIFQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S5e-171106190Myocyte-specific enhancer factor 2B
1tqe_R5e-171106190Myocyte-specific enhancer factor 2B
1tqe_Q5e-171106190Myocyte-specific enhancer factor 2B
1tqe_P5e-171106190Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1368200.0BT136820.1 Lotus japonicus clone JCVI-FLLj-11I9 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004514527.11e-147PREDICTED: agamous-like MADS-box protein AGL12 isoform X1
SwissprotQ388415e-81AGL12_ARATH; Agamous-like MADS-box protein AGL12
TrEMBLA0A072UIB81e-135A0A072UIB8_MEDTR; MADS-box transcription factor
STRINGGLYMA12G00770.11e-120(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF75663144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.13e-82AGAMOUS-like 12